Thread 22 - the one with mad sheep disease

[Reastie]

Thanks to @friskybivalves for the title

I think we might actually make it to 25 threads!!

please post any bargain info IN BOLD to make it easier to scroll through the thread.

To make things bold you:
Put a star each side of what you want to make bold like this but without the space between the star and the writing *

Just a reminder you can watch the thread by clicking on ‘watch this thread’ at the top of the first message. It’s much easier for everyone than so many place marking every time which can use up a fair chunk of each thread to scroll through

Affiliate Advertising policy: Mumsnet carries some affiliate marketing links, which means we earn commission on sales of some products when users click through a link from the site. Our editorial content is NOT influenced by affiliate partnerships. You may not post affiliate links without the prior permission of Mumsnet.

Here’s Barbarara’s instructions from last year on doing clicky links:

Open double square brackets
No space
Paste link
Space
Name of link
No space
Close double square brackets

Like this
[[www.amazingbargains.com bargain ]] but with no space after/before the brackets.
If I do it again without the extra spaces only the word bargain will appear in blue

For more links etc see message 2

If any link doesn’t work or you want to add something please let me know by @ing me

I picked up a switch for £229 at Tesco this morning. They had the normal neon ones and the fortnite one which comes with that game installed. They were on their second lot of stock. Apparently they had sold out at 5:30am and at 9am we picked up the second last one from the new stock. You have to ask for them at customer services.

Now I need to find some good deals on games, if that’s possible!

Wow well done! How did you even know they had any, do they advertise it at all?

@SomethingInTheWaySheCooks have a look at cdkeys for games. I've bought several from them and their customer service has been great when I've (twice ) mistakenly bought the wrong thing.

@Chocoholicmumma that's good to know, thank you. I'll give until Monday too.

@yafilthyanimalandahappynewyear I'm looking forward to getting it. Is it as good as the "carry me home" sets they did the last couple of years? If you got those last year and can compare? We always keep one and gift one.

Thanks LutherRalph

Goblindaughter -yes I reckon a big tin of Farrah's Harrogate toffee.

Thanks for the tip off whoever it was about yhe flaked hot chocolate in M +S. Got ine yesterday.

Underwhelmed by BF too. The only thing I got so far was a tablet for my son for £120 which was £120 in October and somehow mysteriously Jumped To £140 in November ready for BF. The amazon week they gad in October was better.

@InDreamland

I've not received my Hotel Chocolat TSV yet. Got the letter from QVC saying it'll be dispatched direct from Hotel Chocolat but thought it would've been delivered by now. Ordered before it went onto advanced orders. Is anyone else still waiting?

Mine arrived yesterday so hopefully you won't have to wait much longer!

I'm very impressed with the amount of chocolate for the price as it's my present to myself I've hidden it out of reach of the children.

Crash Bandicoot It's About Time PS4 game down to £39.99 on Amazon. There's one with a Tote Bag which my DS will love with the added bonus that the game was on his list!

This big set of candles looks good, on qvc. Could keep for home or split up as gifts /teacher gifts.
With a referral code £10 discount it's a bargain at £15 delivered !

https://www.qvcuk.com/.product.713669.html?source=cht&cmmmc=EmaillTOTDTD--DailyDeallTOTDCAMP9576-8166211167728720201124---CELL135767

Here's my referral code if anyone needs one

mention-me.com/m/ol/jj9sg-cca28766a6

@GoblinDaughter not nicely presented as such, but Tesco have macarons and pigs in blankets for dogs, I've bought some for my friend's dogs

Buckley London jewellery have another Black Friday deal on - today's theme is mixed metals

Damn it, went to order and it's oos. So sorry

@GoblinDaughter I picked up dog treat Christmas crackers in Waitrose last week that were half price down to £2.50 each. Their half price offer on crackers ends today.

Thank you sorryiasked Will check that out now. Looking for a couple of fun 4 player games. Have little idea where to start!

[quote jingleballing]**@GoblinDayghter* @Giblindaughter* how about a tin of very sticky toffee to keep his gob firmly shut ? [/quote]
😂

@InDreamland, this is the first time I have ordered anything like this so I can't compare to it, sorry.

For anyone that has a fitness lover in their lives My Protein have 45% off at the moment.

30% off DMs with code DM30 for men's and DW30 for women's at www.atomretro.com/

@mrsdaz the anker sound core life earphones are great & £29.99 on Black Friday deal at amazon

@GoblinDaughter how about a storm glass

Can anyone recomend a quite difficult wooden puzzle box for dh please? He has just asked for one out of the blue

Anyone who got the fake oddies from Amazon, have you washed/tumbled them and if so did that make them fluffier?

Morning, my daughter would like a Vivienne Westwood necklace for Christmas. I can’t stomach paying full price when it’s inevitably going to get lost in her tangle of of Shein jewellery at some point. Does anyone know of any bargains or discount codes? Thank you.

@GoblinDaughter

Need something for arsehole FiL and really have exhausted all options over the years now, last year’s weather stick was a last resort as couldn’t think of anything, can anyone help? No idea what he likes besides being a trouble making arsehole so 💁‍♀️ Not buying a gift isn’t an option either.

On a nicer note, nice dog treats? I always get a present for a friend’s dog who’s great with my daughter and daughter is equally obsessed with the dog. Last year she had the turkey dinner toys from Pets At Home but wanted to go for some nice little treats this year, but something special, any ideas? Is there anything out there that would come nicely presented, like in a cracker?

How about these dog treats from Lily's Kitchen. Currently 20% off and free delivery. Their crackers are sold out on the website but they had them in pets at home at the weekend.

@WetEcho brandalley sometimes have Vivienne Westwood stuff in? I don't think there's necklaces right now, but they do seem to add things daily so might be worth checking?

I'm also still waiting on qvc hotel
Chocolat, very excited to see people's have been arriving!
Also waiting on the Christmas collection 🐷 although the qvc one will make nursery gifts!