Help protect children from gaming harms.

Take our survey

Please or to access all these features

Christmas

From present ideas to party food, find all your Christmas inspiration here.

Thread 22 - the one with mad sheep disease

999 replies

Reastie · 22/11/2020 21:10

Thanks to @friskybivalves for the title

I think we might actually make it to 25 threads!!

please post any bargain info IN BOLD to make it easier to scroll through the thread.

To make things bold you:
Put a star each side of what you want to make bold like this but without the space between the star and the writing *

Just a reminder you can watch the thread by clicking on ‘watch this thread’ at the top of the first message. It’s much easier for everyone than so many place marking every time which can use up a fair chunk of each thread to scroll through Thanks

Affiliate Advertising policy: Mumsnet carries some affiliate marketing links, which means we earn commission on sales of some products when users click through a link from the site. Our editorial content is NOT influenced by affiliate partnerships. You may not post affiliate links without the prior permission of Mumsnet.

Here’s Barbarara’s instructions from last year on doing clicky links:

Open double square brackets
No space
Paste link
Space
Name of link
No space
Close double square brackets

Like this
[[www.amazingbargains.com bargain ]] but with no space after/before the brackets.
If I do it again without the extra spaces only the word bargain will appear in blue

For more links etc see message 2

If any link doesn’t work or you want to add something please let me know by @ing me Thanks

OP posts:
Thread gallery
58
SomethingInTheWaySheCooks · 24/11/2020 09:21

I picked up a switch for £229 at Tesco this morning. They had the normal neon ones and the fortnite one which comes with that game installed. They were on their second lot of stock. Apparently they had sold out at 5:30am and at 9am we picked up the second last one from the new stock. You have to ask for them at customer services.

SomethingInTheWaySheCooks · 24/11/2020 09:22

Now I need to find some good deals on games, if that’s possible!

Iggi999 · 24/11/2020 09:24

Wow well done! How did you even know they had any, do they advertise it at all?

sorryiasked · 24/11/2020 09:29

@SomethingInTheWaySheCooks have a look at cdkeys for games. I've bought several from them and their customer service has been great when I've (twice Blush) mistakenly bought the wrong thing.

InDreamland · 24/11/2020 09:30

@Chocoholicmumma that's good to know, thank you. I'll give until Monday too.

@yafilthyanimalandahappynewyear I'm looking forward to getting it. Is it as good as the "carry me home" sets they did the last couple of years? If you got those last year and can compare? We always keep one and gift one.

margaritasbythesea · 24/11/2020 09:32

Thanks LutherRalph

Goblindaughter -yes I reckon a big tin of Farrah's Harrogate toffee.

Thanks for the tip off whoever it was about yhe flaked hot chocolate in M +S. Got ine yesterday.

Underwhelmed by BF too. The only thing I got so far was a tablet for my son for £120 which was £120 in October and somehow mysteriously Jumped To £140 in November ready for BF. The amazon week they gad in October was better.

Choconuts · 24/11/2020 09:38

@InDreamland

I've not received my Hotel Chocolat TSV yet. Got the letter from QVC saying it'll be dispatched direct from Hotel Chocolat but thought it would've been delivered by now. Ordered before it went onto advanced orders. Is anyone else still waiting?
Mine arrived yesterday so hopefully you won't have to wait much longer!

I'm very impressed with the amount of chocolate for the price as it's my present to myself I've hidden it out of reach of the children.

unkindnessofravens · 24/11/2020 09:41

Crash Bandicoot It's About Time PS4 game down to £39.99 on Amazon. There's one with a Tote Bag which my DS will love with the added bonus that the game was on his list!

jingleballing · 24/11/2020 09:42

This big set of candles looks good, on qvc. Could keep for home or split up as gifts /teacher gifts.
With a referral code £10 discount it's a bargain at £15 delivered !

https://www.qvcuk.com/.product.713669.html?source=cht&cmmmc=EmaillTOTDTD--DailyDeallTOTDCAMP9576-8166211167728720201124---CELL135767

Here's my referral code if anyone needs one

mention-me.com/m/ol/jj9sg-cca28766a6

ClaraTheImpossibleGirl · 24/11/2020 09:48

@GoblinDaughter not nicely presented as such, but Tesco have macarons and pigs in blankets for dogs, I've bought some for my friend's dogs Grin

Buckley London jewellery have another Black Friday deal on - today's theme is mixed metals

jingleballing · 24/11/2020 09:49

Damn it, went to order and it's oos. So sorry Sad

WhereTheresAHill · 24/11/2020 09:49

@GoblinDaughter I picked up dog treat Christmas crackers in Waitrose last week that were half price down to £2.50 each. Their half price offer on crackers ends today.

SomethingInTheWaySheCooks · 24/11/2020 09:55

Thank you sorryiasked Will check that out now. Looking for a couple of fun 4 player games. Have little idea where to start!

Lellyo · 24/11/2020 09:57

[quote jingleballing]**@GoblinDayghter* @Giblindaughter* how about a tin of very sticky toffee to keep his gob firmly shut ? Grin[/quote]
😂

yafilthyanimalandahappynewyear · 24/11/2020 09:58

@InDreamland, this is the first time I have ordered anything like this so I can't compare to it, sorry.

Cluckycluck · 24/11/2020 10:00

For anyone that has a fitness lover in their lives My Protein have 45% off at the moment.

BendyBusBuggy · 24/11/2020 10:12

30% off DMs with code DM30 for men's and DW30 for women's at www.atomretro.com/

buckeejit · 24/11/2020 10:14

@mrsdaz the anker sound core life earphones are great & £29.99 on Black Friday deal at amazon

CarrotVan · 24/11/2020 10:15

@GoblinDaughter how about a storm glass

ToastandJamandTea · 24/11/2020 10:17

Can anyone recomend a quite difficult wooden puzzle box for dh please? He has just asked for one out of the blue Confused

Theimpossiblegirl · 24/11/2020 10:19

Anyone who got the fake oddies from Amazon, have you washed/tumbled them and if so did that make them fluffier?

WetEcho · 24/11/2020 10:22

Morning, my daughter would like a Vivienne Westwood necklace for Christmas. I can’t stomach paying full price when it’s inevitably going to get lost in her tangle of of Shein jewellery at some point. Does anyone know of any bargains or discount codes? Thank you.

Beaglemum93 · 24/11/2020 10:28

@GoblinDaughter

Need something for arsehole FiL and really have exhausted all options over the years now, last year’s weather stick was a last resort as couldn’t think of anything, can anyone help? No idea what he likes besides being a trouble making arsehole so 💁‍♀️ Not buying a gift isn’t an option either.

On a nicer note, nice dog treats? I always get a present for a friend’s dog who’s great with my daughter and daughter is equally obsessed with the dog. Last year she had the turkey dinner toys from Pets At Home but wanted to go for some nice little treats this year, but something special, any ideas? Is there anything out there that would come nicely presented, like in a cracker?

How about these dog treats from Lily's Kitchen. Currently 20% off and free delivery. Their crackers are sold out on the website but they had them in pets at home at the weekend.
villamariavintrapp · 24/11/2020 10:30

@WetEcho brandalley sometimes have Vivienne Westwood stuff in? I don't think there's necklaces right now, but they do seem to add things daily so might be worth checking?

Givealittlebit · 24/11/2020 10:33

I'm also still waiting on qvc hotel
Chocolat, very excited to see people's have been arriving!
Also waiting on the Christmas collection 🐷 although the qvc one will make nursery gifts!

Swipe left for the next trending thread