Meet the Other Phone. Child-safe in minutes.

Meet the Other Phone.
Child-safe in minutes.

Buy now

Please or to access all these features

Chat

Join the discussion and chat with other Mumsnetters about everyday life, relationships and parenting.

Horrible symptoms when I eat eggs. Intolerance?

21 replies

Invasionofthegutsnatchers · 25/09/2021 20:45

Griping gnawing stomach pain, upset stomach, bloating, churning gurgling stomach, nausea.

I've kept a food diary and it only happens after I eat eggs. Is this an intolerance?

OP posts:
PsychoSyd · 25/09/2021 20:50

Sounds like me OP. It's an intolerance to the protein strings found in eggs. It started suddenly for me about 13 years ago. I can't eat eggs anymore which I'm really cross about because I bloody love them!

Invasionofthegutsnatchers · 25/09/2021 20:55

I'm cross too! But relieved it's nothing more sinister.

OP posts:
NiceGerbil · 25/09/2021 20:57

Probably! I mean it seems clear cut.

Loads of things have egg/ egg powder etc in so you'll need to check your usual buys for a bit till you get used to it.

Interested in this thread?

Then you might like threads about these subjects:

MildCreamyCheddar · 25/09/2021 20:57

Definitely sounds like intolerance. That's the same symptoms I get with dairy.

HeronLanyon · 25/09/2021 21:01

I’ve very recently had very upset stomach after eggs. First time thought it was maybe an old egg but now it’s happened three times. Mid 59s. Only in the last few years have I perfected poaching. I love eggs.
Still in denial.

romdowa · 25/09/2021 21:03

This is how mine started in my early 20s, It then progressed to facial swelling and a wheeze in my chest. I now have to have epi pens for my allergy.

HirplesWithHaggis · 25/09/2021 21:04

I'm weird with eggs. I'm fine with yolk, but can't eat the white. Unless it's been thoroughly beaten, so I can eat cakes and even meringues with impunity. Was told it's to do with breaking the protein strands a pp mentioned.

Invasionofthegutsnatchers · 25/09/2021 21:05

Oh really @romdowa how awful!

I seem to be OK with cakes etc but fried or scrambled eggs definitely do not agree with me.

OP posts:
Invasionofthegutsnatchers · 25/09/2021 21:07

I can't actually stand the taste of egg white, it makes me retch. Dippy egg yolks or thoroughly scrambled eggs are so nice though

OP posts:
MissBridgetJones · 25/09/2021 21:09

@HirplesWithHaggis

I'm weird with eggs. I'm fine with yolk, but can't eat the white. Unless it's been thoroughly beaten, so I can eat cakes and even meringues with impunity. Was told it's to do with breaking the protein strands a pp mentioned.
100% same as this. If the egg is a component of a dish, fine.

I cannot tolerate whole egg on its own.

The effects are nuclear. 🤭

Chicchicchicchiclana · 25/09/2021 21:11

I'm not great with eggs. I had gallbladder problems and then gallbladder removal and eggs is one of the foods I have to plan in adavance if I want to eat.

How are you with other fats/dairy?

yafilthyanimalandahappynewyear · 25/09/2021 21:17

I have such a strange experience with this.
Up until my second pregnancy (aged 29) I never had a problem with egg.
Then during that pregnancy I noticed I would be slightly constipated followed by pale stool after eating boiled egg (and only boiled).
11 years later and I had to avoid egg in any capacity as it gave me the symptoms of a stomach bug.
Two years after that (so 13 years after the pregnancy) if I eat something containing egg I will (a few hours later) get stomach cramps and vomit liquid only - even if I've eaten a full meal only liquid comes up. It's now 15 years later.
So I obviously avoid it now at all costs. It's a pain but I'm worried it will turn into a full blown allergy.
So strange really.

Blendabrethin · 25/09/2021 21:19

It could be an intoleramce or a non IGE mediated allergy. It is hard to distunguish between these as the symptoms are very similar but you could ask your GP for a referral to the allergy clinic.

A lot of people don't know about non-IGE mediated allergies because they associate 'allergy' with a histamine response; where you they a rash or breathing difficulty. People tend to put gastric symtoms down to an intolerance. However, an intolerance is where your body is unable to break down a food. A non-IGE mediated allergy is where the immune system overeacts to a protein and can cause gastric symptoms, headaches and even 'silent' anaphylaxis (where you suffer a huge blood pressure drop and collapse a few hours after encountering am allergen) without a histamine type response.

It is important to find out which you have as a non-ige mediated allergy can progress to an IGE mediated allergy with repeated exposure. An allergy would also mean you needed to avoid medications that included egg proteins.

Aimee1987 · 25/09/2021 21:19

It sounds like a non IgE allergy. These are the ones that used to be called intolerances. In these allergies you can often tolerate the more cooked forms of the protein. To check if kids have outgrown allergies you use something called the egg ladder. The "well cooked egg" that you describe is down the bottom of the ladder so easier to tolerate while lightly cooked egg like scrambled egg is near the top. Some kids only make it part way up the ladder before symptoms return. It sounds like you can only tolerate the bottom of the ladder.

HeronLanyon · 25/09/2021 21:19

I’m going to test the yolk/white separately to see if it’s the whites only that have just started to have such an awful effect. Thanks for this thread op

FrenchyQ · 25/09/2021 21:21

Sounds exactly like how I felt after eating egg, mine started after my second pregnancy 15 years ago. I can't eat anything containing egg and even my husband frying an egg makes my lips swell up.

Invasionofthegutsnatchers · 25/09/2021 21:38

If I try to eat egg white I gag.

I'll try to contact my GP but it's nigh on impossible at the moment unless you're at death's door!

OP posts:
earlydoors42 · 25/09/2021 21:40

I've been like this the last few years too. I love to eat scrambled eggs but then I get stabbing pains in my stomach that make me bend forward. Cake still ok though. This thread is useful, thank you

Ivchangedmynameforthis · 25/09/2021 21:44

I get this too. I can eat cakes etc with cooked egg in it but can’t eat an egg in any other form. I can’t eat Mayo either unless it’s vegan Mayo.

Aimee1987 · 25/09/2021 21:46

@Invasionofthegutsnatchers

If I try to eat egg white I gag.

I'll try to contact my GP but it's nigh on impossible at the moment unless you're at death's door!

My 6 month old son had diahorea/ vomiting/ mucoussy bloody stools, horrendous reflux and would scream for hours. It took several phone calls to the gp over the course of months and me basically crying down the phone for them to refer him to peads. We saw a pediatric dietician who identified his non IgE allergies to dairy, egg, soya, nuts and coconut. Allergy services in the UK are shit to put it mildly.
BiddyPop · 25/09/2021 21:51

I did find that I couldn't eat hard yolks with bloating, gas, cramps the result. But I'm ok having eggs in baking, egg whites, soft yolks (boiled and fried), sauces like fried rice or carbonara, or mixed up as omelettes/scrambled etc.

I think it's something in the layer that goes grey immediately surrounding the yolk when it gets hard.

It may not be the same as you, but it might be worth trying different types (slowly, controlled, over time). And I know you can buy egg whites in bottles now already separated.

New posts on this thread. Refresh page
Swipe left for the next trending thread